<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2001-097 2001-097 Puerto Rico 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23LI, K43T Q18L, K20T, E35G, M36I, N37S, R57K, I62V, L63P, A71T, I72IT, V77I, I93L  
>2001-097| codons 14-99
KIGGLLTEAILDTGADDTVLEGISLPGRWTPKMIGGIGGFIKVKQYDQVPIEICGHKTTG
TVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V   L100I, K103N   T39X, R83K, D177E, Q207A, R211RK, F214FL  
>2001-097| codons 39-234
XEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPA
GIKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGLTTPD
KKHQKEPPFLWMGYEL

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016