<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2003-022 2003-022 Puerto Rico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   K20I, L33V, D60E, L63P, A71T, I85V  
>2003-022| codons 14-99
KIGGQLIEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYEQIPIEICGHKTIG
TVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016