<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2003-067 2003-067 Puerto Rico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L N88D I15V, K20T, N37S, L38I, Q61N, L63LV, I64V, I66IF, A71V, I72V, V77I  
>2003-067| codons 14-99
KVGGQLTEALLDTGADNTVLEEMSIPGRWKPKLIGGIGGFIKVRQYDNIVVEFCGHKVVG
TVLIGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016