<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2003-108 2003-108 Puerto Rico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73C E35G, M36I, K55R, I62V, L63P, I64V, I66V, I72IV, T74S, I85V, I93L A28AS
>2003-108| codons 14-99
KIGGQLKEALLDTGSDDTVLEGINLPGRWKPKIIGGIGGFIRVRQYDQVPVEVCGHKAVC
SVLVGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y K219N   A98G I37X, T39TA, K43KE, E44D, K82KR, V118I, K122E, T139TA, D177G, G196E, E203K, H208Y, R211K, K223E, L228X V111VM
>2003-108| codons 37-234
XCAELEEDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNRRTQDFWEVQLGIPH
PGGLKKKKSVTVLDMGDAYFSIPLDEDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPGIVIYQYMDDLYVGSDLEIEQHRTKIKELRQYLWKWGFYT
PDNKHQEEPPFXWMGYEL

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016