<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2003-160 2003-160 Puerto Rico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47A   K14R, I15V, G16GW, L19I, K20T, M36I, R41K, I62V, I64V, T74A  
>2003-160| codons 14-99
RVWGQITEALLDTGADDTILEEINLPGKWKPKMAGGIGGFIKVRQYDQVLVEICGHKAIG
AVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016