<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2003-188 2003-188 Puerto Rico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82T, L90M G73GS K20L, N37NS, I62IV, L63P, H69Y, A71V, I72IL, V77I, I85V  
>2003-188| codons 14-99
KIGGQLLEALLDTGADDTVLEEMSLPGRWKPKMIVGIGGFVKVRQYDQVPIEICGYKVLS
TVLIGPTPTNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       I37X, E40EV, V60I, S68G, I135T, I142X, R211K, L228H  
>2003-188| codons 37-234
XCTVLEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGXRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYT
PDKKHQKEPPFHWMGYEL

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016