<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2009-007 2009-007 Puerto Rico 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M G73T L19LI, K20M, I62V, L63P, I72V  
>2009-007| codons 14-99
KIGGQIMEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQVPIEICGHKAVT
TVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016