<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2009-007 2009-007 Puerto Rico 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M G73T L19LI, K20M, I62V, L63P, I72V  
>2009-007| codons 14-99
KIGGQIMEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQVPIEICGHKAVT
TVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N K103N, M230L V108VI T39TS, E44D, S48ST, K49R, V60I, V106I, V118VI, K122E, Y146YF, S162C, E169D, T200A, E203D, Q207E, R211K I37IFLV, G45GR, V111VGLW, A129AS, P140PQ
>2009-007| codons 37-244
VCSELEKDRKITRIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKNKSITILDWGDAYFSIPLDEDFRKYTSFTIPSINNETQGIRYQFNVLPQGWKGS
PAIFQCSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIDELREHLWKWGFYT
PDNKHQKEPPFLWLGYELHPDKWTVQPI

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016