<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2010-002 2010-002 Puerto Rico 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, L63V, C67CY, L89M G17GR
>2010-002| codons 14-99
KIGRQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYDQIVIEIYGHKAIG
TVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, T39A, E40D, D121H, K122E, D123S, S162A, Q174K, D177E, T200N, Q207E, F214L V148VE, G155GV
>2010-002| codons 30-244
QIGCTLNFCADMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGIRYQYNEL
PQGWKVSPAIFQASMTKILEPFRKKNPEIVIYQYMDDLYVGSDLEIGQHRNKIEELREHL
LRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016