<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DGP145 DGP145 India 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106M, G190A F227L V35T, T39E, S48T, V60I, D121Y, K122E, I135R, K173A, D177E, I178M, T200A, Q207E, V245Q, A272P, K277R, E291D, V292I, I293V  
>DGP145| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEMVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I15V, L19I, M36I, R41K, H69K, I72V, I93L  
>DGP145| codons 1-99
PQITLWQRPLVSIRVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Acharya, A Development, validation and clinical evaluation of a low cost in-house HIV-1 drug resistance genotyping assay for Indian patients. PLoS ONE, 2014