<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DGP185 DGP185 India 2013 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 ATV+RTV+TDF+3TC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, N88S L24I, L33F, Q58E L5I, L10V, I13V, I15V, E35D, M36I, N37E, R41K, R57K, D60E, H69K, A71V, L89M  
>DGP185| codons 1-99
PQITIWQRPVVTVKVGGQLKEALIDTGADDTVFEDIELPGKWKPKIIGGIGGFVKVKEYE
QILIEICGKKVIGTVLVGPTPANIIGRSMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y V75M K101E, Y188L   K11E, V35T, V60I, V106I, D121Y, K122E, D123G, T165I, K173T, Q174N, D177E, Q197K, T200A, Q207A, R211S, V245K, D250E, T286A, E291D, V292I, I293V, P294T  
>DGP185| codons 1-300
PISPIETVPVELKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSITVLDVGDAYFSVPL
YEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTNNPEIVI
YQYVDDLLVGSDLEIGKHRAKIEELRAHLWSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE

References
Author Title Citation
Acharya, A Development, validation and clinical evaluation of a low cost in-house HIV-1 drug resistance genotyping assay for Indian patients. PLoS ONE, 2014