<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
YNBS21HS YNBS21HS China 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, G16E, E35D, M36I, R41K, R57K, H69K, L89I, Q92K  
>YNBS21HS| codons 1-99
PQITLWQRPLVTVKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNILTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43Q, V60I, S68G, K122E, D123N, K166R, K173I, Q174K, D177E, T200A, Q207A, K238R, V245T, A272P, K275R, V276I, T286A, E291D  
>YNBS21HS| codons 1-291
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEQEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIRIKQLCKLLRGAKALTD

References
Author Title Citation
Feng, Y Diverse intersubtype recombinants and high frequency of drug-resistance mutations of HIV-1 among newly diagnosed and antiretroviral treatment naive HIV-infected individuals in Baoshan, a western prefecture of Yunnan, China. Unpublished, 2016