<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NP246 NP246 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>NP246| codons 4-98
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N P225H, K238T T39K, K43E, D121H, K122E, D123S, K173T, Q174K, D177E, I178M, T200A, Q207A, R211S, V245E  
>NP246| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPEMVIYQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTP
DQKHQKEHPFLWMGYELHPDTWTVQPIELP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005