<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G516 G516 Thailand 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6R, T12R, L19I, L63A, K70Q, V77I  
>G516| codons 4-98
TLRQRPLVRIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIA
IEICGHQAIGTVLIGPTPVNIIGRNLLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184I K219Q   V179D I50T, K103R, I135T, G196E, R211S, F214L, D218E  
>G516| codons 38-247
CTEMEKEGKISKTGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDIYQYIDDLYVGSDLEIEQHRTKIEELRQHLLSWGLTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005