<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0139 14-0139 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6R, I13V, K20I, E35D, M36I, R41K, H69K, K70R, V82I, L89M  
>14-0139| codons 4-98
TLRQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67G, K219Q   V108I T39K, K43E, V60I, S68G, T107S, L109V, V118C, K122E, D123N, K166R, K173N, Q174K, D177E, I178M, T200A, I202V, Q207A, R211S  
>14-0139| codons 38-243
CKEMEEEGKISKIGPENPYNTPIFAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVSIVDVGDAYFSCPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRNKNPEMVIYQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005