<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0115 14-0115 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A L33F, K43T, N83D L10I, I13V, E35D, M36I, R41K, I62V, H69K, L89M  
>14-0115| codons 4-98
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEDINLPGKWTPKMIGGIGGFIKVRQYDQVL
IEICGKKAIGTVLVGPTPADIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39K, K43E, T69N, G112A, K122E, D123S, S162C, K173I, Q174K, D177E, T200I, Q207T, R211S, K238R, V245E  
>14-0115| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVADAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHRIKIEELRTHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005