<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0102 14-0102 Thailand 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L G48R, N83D, L89V W6R, I13V, L33V, E35D, M36V, N37D, R41K, K55R, I62V, L63P, H69K  
>14-0102| codons 4-98
TLRQRPLVTVKIGGQLKEALLDTGADDTVVEDVDLPGKWKPKLIRGIGGFIRVRQYDQVP
IEICGKKAIGTVLVGPTPVDIIGRNVLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N A98G T39E, K64Y, K122E, D123S, E138Q, K173I, Q174K, D177E, I178L, T200I, Q207A, R211S, L228H, V245E  
>14-0102| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIYKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRIKNPELVIYQYVDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTP
DQKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005