<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0066 14-0066 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10H, I13V, G16E, K20R, E35D, M36I, R41K, H69K, K70R, L89M, I93V  
>14-0066| codons 4-98
TLWQRPHVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKRAIGTVLVGPTPVNIIGRNMLTQVGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39K, K43E, K122E, D123S, I135L, S162C, R172K, K173R, Q174E, D177E, I178M, T200A, E204K, Q207A, R211S, V245E  
>14-0066| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFKRENPEMVIYQYMDDLYVGSDLEIGQHRAKIEKLRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005