<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HG030 HG030 U.S. 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, L63P, H69K, L89M, I93L  
>HG030| codons 4-99
TLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, A98S, K173A, D177E, T200A, Q207E, R211K, V245Q  
>HG030| codons 40-247
EMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSG
LKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRAQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Hanna, G Drug-selected resistance mutations and non-B subtypes in antiretroviral-naive adults with established human immunodeficiency virus infection. J Infect Dis, 2003