<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0056 14-0056 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A V108I T39K, K43E, V106I, T107S, K122E, D123S, S162C, K173I, Q174K, D177E, Q207A, R211S, K238R, V245E  
>14-0056| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSISILDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRIKNPEIVIYQYVDDLYVASDLEIGQHRTKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005