<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0050 14-0050 Thailand 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6R, I62V, V77I  
>14-0050| codons 4-98
TLRQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQVL
IEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N K219Q     V60I, A98S, K122P, S162D, P176S, D177E, I178L, G196E  
>14-0050| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNSELVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005