<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0044 14-0044 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219N Y181C V179D T39K, K43E, S68G, K102R, K103R, V111I, D121H, K122E, D123S, K173I, Q174K, D177E, Q207A, R211S, K238R, V245E  
>14-0044| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRRKSVTVLDIGDAYFSVPLHESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRIKNPEIDICQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTP
DNKHQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005