<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14-0037 14-0037 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V   L10I, I13V, K20T, E35D, M36I, R41K, H69K, L89M  
>14-0037| codons 4-98
TLWQRPIVTVKIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184I, T215F V75M, K219Q K103N, V106A A98G T39E, G45X, K73M, K102R, K122E, D123S, I135T, K173I, Q174K, D177E, I178M, T200A, Q207A, R211S, D218E, K238R, V245Q T165R
>14-0037| codons 38-247
CEELEKEXKISKIGPENPYNTPVFAIKKKNSTRWRMLMDFRELNKRTQDFWEVQLGIPHP
GGLKRNKSATVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMRKILEPFRIKNPEMVIYQYIDDLYVGSDLEIGQHRAKIEELRAHLLSWGFFTP
EQKHQKEPPFLWMGYELHPDRWTVQPIQLP

References
Author Title Citation
Chantratita, W Prevalence of mutations related to HIV-1 antiretroviral drug resistance in Thailand, 2003. Unpublished, 2005