<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G58 G58 Thailand 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L89V I13V, K20T, E35D, M36I, R41K, I62V, H69K, A71T, T74S  
>G58| codons 1-99
PQITLWQRPLVTVKIGGQLTEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QVLIEICGKKTIGSVLVGPTPVNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     E6D, K11T, K20R, V35T, T39K, K43E, V60I, K102Q, K122E, D123S, K173I, Q174K, D177E, I178M, T200R, Q207A, R211S, V245K, T286A, E291D, V292I, I293V, E312A  
>G58| codons 1-323
PISPIDTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRRKIEELRAHLLSWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKAPVHGVYYDPSK

References
Author Title Citation
Chantratita, W Prevalence of HIV-1 polymerase gene mutations in pre-treated patients in Thailand. Southeast Asian J Trop Med Public Health, 2002