<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G77 G77 Thailand 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, H69K, L89M  
>G77| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y188L   E6D, V35T, T39K, K43E, V60I, S68G, K122E, D123N, I135T, K166R, K173I, Q174K, D177E, I178M, T200I, Q207A, R211S, V245E, V276I, T286A, V292I, I293V, E312N  
>G77| codons 1-324
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEMVI
YQYVDDLLVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKNPVHGVYYDPSKD

References
Author Title Citation
Chantratita, W Prevalence of HIV-1 polymerase gene mutations in pre-treated patients in Thailand. Southeast Asian J Trop Med Public Health, 2002