<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL245 VL245 Thailand 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, L90M L33F, F53L, N83D L10I, I13V, E35D, M36I, R41K, K43Q, L63P, H69K, L89I  
>VL245| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEDINLPGKWQPKMIVGIGGLIKVRQYD
QIPIEICGKKAIGTVLVGPTPVDIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F V75M, K219Q K101E, G190A   E6D, K11T, V35T, T39K, K43E, V60I, T69N, K122E, D123S, K173I, Q174K, D177E, I178M, Q207A, R211S, L228H, K238R, V245K, T286A, E291D, V292I, I293V, E312T  
>VL245| codons 1-313
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVASDLEIGQHRTKIEELRAHLLSWGFFTPDQKHQKEPPFHWMGYELHPDRWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTP

References
Author Title Citation
Chantratita, W Prevalence of HIV-1 polymerase gene mutations in pre-treated patients in Thailand. Southeast Asian J Trop Med Public Health, 2002