<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR06 DR06 Cameroon 2012 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, L19V, K20KR, E35N, M36I, N37D, R41K, Q61G, L63T, E65D, H69K, L89M  
>DR06| codons 1-99
PQITLWQRPVVTVRIEGQVREALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
GITIDICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K103N   K11M, K20R, V35T, S48T, K49R, V60I, K102Q, D121Y, K122E, E138Q, E169D, K173A, Q174K, D177E, I178IM, G196E, Q207E, R211K, F214L, V245K, E248D, A272P, K281R, L283LF, E291D, I293V, E297R, A304E, E312N, G335D  
>DR06| codons 1-335
PISPIETVPVMLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKITRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPEMVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLFRGTKALTDVVPLTREAE
LELEENREILKNPVHGVYYDPSKDLIAEIQKQGQD

References
Author Title Citation
Jenabian, MA Pitfalls of antiretroviral drug resistance genotyping of HIV-1 Group M and Group N from Cameroon by sequenced-based assays. Niger Med J, 2015