<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HCIII-00327048 HCIII-00327048 Spain 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 TDF+FTC+NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F Q58E L10I, K14KR, G16GE, Q18QE, K20KR, E35D, M36I, R41K, I62V, L63P, L89M, I93L  
>HCIII-00327048| codons 1-99
PQITLWQRPIVTIRIEGELREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVREYD
QVPIEICGHKAIGTVLVGPTPFNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N V75I Y181C   I31L, T39E, V60I, R83K, V90I, S162Y, V179I, G196E, E203D, R211K, T215X, A272AP, K277R, Q278QE, T286P, I293V, E297K, E312T, D324E, I326V, Q334L  
>HCIII-00327048| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICEELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLIDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIEQHRTKIDELRQHLLKWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRELCKLLRGPKALTEVVPLTKEAE
LELAENREILKTPVHGVYYDPSKELVAEIQKQGLG

References
Author Title Citation
Betancor, G Clinical, virological and biochemical evidence supporting the association of HIV-1 reverse transcriptase polymorphism R284K and thymidine analogue resistance mutations M41L, L210W and T215Y in patients failing tenofovir/emtricitabine therapy. Retrovirology, 2012