<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HCIII-00350168 HCIII-00350168 Spain 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 TDF+FTC+NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82C V32A, L33F, Q58E L10I, I13V, K20R, E34N, E35D, M36I, K55R, V56I, D60E, I62V, L63P, I64L, A71V, I85V, L89M  
>HCIII-00350168| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTAFNDINLPGRWKPKIIGGIGGFVRIREYE
QVPLEICGHKVIGTVLVGPTPCNIVGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     E6EK, V35K, T39A, K43KE, V118I, K122E, I202V, E203D, H208Y, R211K, A272P, I293V, E297K, I309IV, I329IV, G333E  
>HCIII-00350168| codons 1-335
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVDELRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREVLKEPVHGVYYDPSKDLIAEVQKQEQG

References
Author Title Citation
Betancor, G Clinical, virological and biochemical evidence supporting the association of HIV-1 reverse transcriptase polymorphism R284K and thymidine analogue resistance mutations M41L, L210W and T215Y in patients failing tenofovir/emtricitabine therapy. Retrovirology, 2012