<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HCIII-00406922 HCIII-00406922 Spain 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 TDF+FTC+NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, L90M G73T L10I, K20KR, E34ED, E35D, M36X, N37Q, K45KR, L63P, K70KT, A71V, V77VI, I93L  
>HCIII-00406922| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLDDXQLPGRWKPRMIGGIGGFVKVRQYD
QIPIEICGHTVITTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E Y181C   V35X, T39A, K122E, I135T, T139TA, R172RK, I195IM, G196E, T200A, E203K, E204D, Q207QE, K223E, L228R, A272AP, I293IV, V317A, D324E, I329L, Q334N, G335D  
>HCIII-00406922| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALXEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVI
CQYMDDLYVGSDLEMEQHRAKIKDLREHLLRWGFFTPDEKHQEEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKELIAELQKQGND

References
Author Title Citation
Betancor, G Clinical, virological and biochemical evidence supporting the association of HIV-1 reverse transcriptase polymorphism R284K and thymidine analogue resistance mutations M41L, L210W and T215Y in patients failing tenofovir/emtricitabine therapy. Retrovirology, 2012