<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HCIII-00415704 HCIII-00415704 Spain 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 TDF+FTC+NRTI+NNRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75M K103N, G190A   V35T, V60I, A98S, K122E, D123S, Y146S, V148G, S163N, R172RK, K173I, Q174K, D177E, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, K277R, T286A, A288T, E291D, V292VI, I293V, E297A, V317G, D324E, I329V, Q334L, G335D N147H, Q151QP, D218DY, Y318YH
>HCIII-00415704| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQSHGLPPGWKGSPAIFQSNMTKILEPFKIKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELRKHLLSWGFTTPYKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGGHYDPSKELIAEVQKQGLD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, R41K, H69K, V82I, L89M  
>HCIII-00415704| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Betancor, G Clinical, virological and biochemical evidence supporting the association of HIV-1 reverse transcriptase polymorphism R284K and thymidine analogue resistance mutations M41L, L210W and T215Y in patients failing tenofovir/emtricitabine therapy. Retrovirology, 2012