<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYHIVDR165 MYHIVDR165 Malaysia 2013 HIV1 CRF45_cpx Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, M36I, R41K, L63P, H69K, I72V, V82I, L89M, I93L  
>MYHIVDR165| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAVGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F K219Q K101E, Y181C V108I E6D, E28K, V35T, T39K, K43E, T69N, K122E, D123S, K173I, Q174K, D177E, T200I, Q207A, R211S, L228R, K238R, V245E  
>MYHIVDR165| codons 1-254
PISPIDTVPVKLKPGMDGPKVKQWPLTKEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYVDDLYVGSDLEIGQHRIKIEELRAHLLSWGFFTPDQKHQKEPPFRWMGYELHPDRWT
VQPIELPEKDSWTV

References
Author Title Citation
Zain, RM Drug resistance mutations among virological failure HIV-1 infected patients in Malaysia. Unpublished, 2015