<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYHIVDR166 MYHIVDR166 Malaysia 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, G16E, E35D, M36I, I62V, L63S, H69K, L89M  
>MYHIVDR166| codons 1-99
PQITLWQRPLVTVKVEGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVSIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, K43E, K122E, D123S, S162A, K173I, Q174K, D177E, I178M, T200K, Q207V, K238R, V245D, T286A, E291D, V292I, I293V, E312T  
>MYHIVDR166| codons 1-329
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRKKIEELRVHLLRWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIDLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIAEI

References
Author Title Citation
Zain, RM Drug resistance mutations among virological failure HIV-1 infected patients in Malaysia. Unpublished, 2015