<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYHIVDR025 MYHIVDR025 Malaysia 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, R41K, D60E, H69K, L89M, I93L  
>MYHIVDR025| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N A98G, K238T E6D, K20KR, V35T, T39K, K43E, V60I, K102R, K122E, D123X, I135IT, K173X, Q174K, D177E, I178M, V179T, Q207A, R211S, L228H, V245E, V276I, T286A, E291D, I293V, E312T  
>MYHIVDR025| codons 1-327
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKRNKSVTVLDVGDAYFSVPL
DEXFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRXKNPEMTI
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDQKHQKEPPFHWMGYELHPDTWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIA

References
Author Title Citation
Zain, RM Drug resistance mutations among virological failure HIV-1 infected patients in Malaysia. Unpublished, 2015