<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MYHIVDR128 MYHIVDR128 Malaysia 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   M230L V179D E6D, K11T, K20R, V35T, T39K, K43E, K103R, K122E, D123N, K173A, Q174K, D177E, I178M, Q207A, R211S, F214L, V245E, T286A, E291D, V292I, I293V, E312T  
>MYHIVDR128| codons 1-330
PISPIDTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEMDI
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGLYTPDKKHQKEPPFLWLGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIAEIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36V, H69K, L89M  
>MYHIVDR128| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEVNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zain, RM Drug resistance mutations among virological failure HIV-1 infected patients in Malaysia. Unpublished, 2015