<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
0341RI 0341RI Brazil 2005 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NRTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, E10D, V31I, V79A, L101I, S119P, T122I, T124A, T125A, T206S, I208L, Q216N S283S_S
>0341RI| codons 1-288
FLDGIEKAQDEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHAASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FISAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDLQTKELQKNITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12P, I15V, G16E, E35D, M36T, N37E, R41K, R57K, Q61N, L63C, I72T  
>0341RI| codons 1-99
PQITLWQRPVVPIKVEGQLKEALLDTGADDTVLEDTELPGKWKPKMIGGIGGFIKVKQYD
NICIEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, A98S, I178L, V245I, D250E, A272P, K281R, I293V, K311R, G333E, M357T, T386V, A400T, L452Q, S468P, A554N  
>0341RI| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKVPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKQGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Melo, FL Characterization of primary isolates of HIV type 1 CRF28_BF, CRF29_BF, and unique BF recombinants circulating in So Paulo, Brazil. AIDS Res Hum Retroviruses, 2012