<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1274 CA39309 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 187
2 AZT+DDC+SQV 100
3 3TC+DDI 20
4 3TC+D4T+IDV 23
5 DDC+RTV+SQV 20
6 AZT+DLV+NFV+SQV 18
7 3TC+DDI+IDV 23
8 ABC+D4T+DDI+EFV 14
9 D4T+DDI+IDV+RTV 95
10 None 76

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M Q58E, G73GS L10I, I15V, L19LP, K20V, M36I, I62V, L63P  
>CA39309| codons 1-99
PQITLWQRPIVTIKVGGQPVEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVREYD
QVPIEICGHKAISTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215F K219Q     K70X, K102Q, K122E, D123DE, I135V, D177E, G196E, I202V, V245VELQ, E248ED, A272G, A288S, I293V D250DH
>CA39310| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTXWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKHSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGTKSLTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005