<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2306 CA39303 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 70
2 D4T 35
3 3TC+D4T 74
4 3TC+AZT+DDC+IDV 48
5 ADV+DLV+RTV+SQV 54
6 3TC+ABC+AZT+EFV 29
7 ABC+D4T+DDI 44
8 3TC+APV+LPV 23
9 None 42
10 3TC+ABC+DDI+LPV 67
11 3TC+AZT+LPV+TDF 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V Q58E L10I, K20R, M36I, N37S, R41K, K55R, L63P  
>CA39303| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEISLPGKWKPKIIGGIGGFVRVREYD
QIPIEICGHKAIGTVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L74LV, Y115YF, M184V D67DG     I31IL, V35R, K102KR, K122E, I135T, S162C, A272S, P294T  
>CA39304| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALREICTELEKEGKISKIGPENPYNTPV
FAIKKKGSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAFFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVITLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005