<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1141 CA39294 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 17
2 3TC+AZT+IDV 27
3 3TC+D4T+DDI 9
4 3TC+D4T+IDV 21
5 3TC+DLV+RTV+SQV 53
6 3TC+D4T+RTV+SQV 33
7 3TC+D4T+DDI+IDV 164
8 3TC+LPV+TDF 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, V75T, M184V, L210W, T215Y K219N L100I, K103N   V35M, T39A, E40F, K43E, K49KR, V118I, K122E, D177N, G196E, R211K, D218E, V245E, A272P, I293V  
>CA39294| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAFLEEEGKISRIGPENPYNTPV
FAIKKKNSDKWRKITDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I50V, I54V, V82T G73C L10I, I15V, K20R, M36I, N37D, K55KR, I62V, L63P, A71AITV, I72E, I85V  
>CA39293| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEEIDLPGRWKPKMIMGVGGFVRVRQYD
QVPIEICGHKVECTVLVGPTPTNIVGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005