<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16474 CA39134 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, K122E, I178V, G196E, Q207R, R211K, F214L, A272P, V276IT, K277R, T296S, E297R, V317A, D324P, G333E, G335S, R356K, R358K, K395R, E399D, V435A, R461K, Q464H, L469I, T470A, H483L, L517I, V531I, A534T, A554N, K558R  
>CA39134| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDVVI
YQYVDDLYVGSDLEIEQHRTKIEELRRHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTRQLCKLLRGTKALTEVIPLSREAE
LELAENREILKEPVHGAYYDPSKPLIAEIQKQEQSQWTYQIYQEPFKNLKTGKYAKMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQRETWDAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDKGRHKVVSIADTTNQKTELQ
AILLALQDSGLEVNIVTDSQYALGIIQAQPDKSESEIVSQIIEQLIKKEKIYLTWVPAHK
GIGGNEQVDKLVSNGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88ND K14R, I62V, L63P, V77I, I93L  
>CA39133| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009