<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16470 CA39126 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 333

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, M184V V75S     K20KR, V118I, K122KE, T165I, T200I, F214L, V245VM, A272P, T286A, P294T, E297K, K311R, P345S, M357T, T369A, A376V, T386A, A400T, K451R, V458I, D460N, R461K, L491A, Q509L, S519N, K527N  
>CA39126| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLSDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVITLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQESFKNLKTGKYARTRGA
HTNDVKQLAEAVQKIVTESIVIWGKAPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETRLGKAGYITNKGRQKVVSLTDTTNQKTELQ
AIHLALQDSGAEVNIVTDSQYALGIIQALPDKSESELVNQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K14KR, L63AS, A71AT, I72IT, V77VI, I93L  
>CA39125| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKTTGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005