<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16444 CA39074 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 43
2 D4T+DDI+EFV 61
3 ABC+DDI+EFV 52
4 ABC+DDI+EFV+LPV 43
5 ABC+DDI+EFV+TDF 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, K219E G190S   K32R, K102R, D123E, I135T, V179I, V189VI, V245M  
>CA39074| codons 1-260
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYISSDLEIGQHRTKIEELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, H69HR  
>CA39073| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGRKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005