<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4111 CA39061 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 105
2 3TC+AZT+NFV 60
3 Unknown 92

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I15V, K20T, E35D, M36V, P39Q, L63P  
>CA39061| codons 1-99
PQITLWQRPLVTIKVGGQLTEALLDTGADNTVLEDVNLQGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   K103N   K20KQ, T39A, I94IL, K122E, T139K, I142T, F214L, H221HL, T286P, A288S, I293V, E297K W266WC, K275KT, K287KN
>CA39062| codons 1-299
PISPIETVPVKLKPGMDGPQVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGLPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNEKPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKLQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNCASQIYAGITVKQLCKLLRGPNSLTEVVPLTKEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005