<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16436 CA39054 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 3TC+D4T+IDV 207

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82VA L10FV N37S, L63A, I93L  
>CA39054| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKLIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y     F227FL T7TS, K122E, D123N, I135T, T139M, I178M, G196R, T200A, Q207QH E233EDHQ
>CA39055| codons 1-240
PISPIESVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIRQHRAKIEELRHHLWRWGFYTPDKKHQKEPPLLWMGYQLHPDKWT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005