<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1463 CA3905 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 DDI 35
3 Unknown NA
4 3TC+DDI+SQV 78
5 3TC+D4T+IDV 8
6 3TC+D4T+RTV 4
7 D4T+DDI+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M Q58E, G73T L10I, G17D, L63P, A71V, V77T, I93L  
>CA3905| codons 1-99
PQITLWQRPIVTIKIGDQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYD
QIPIEICGHKVITTVLTGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, Q151M, M184V A62V Y181C   V35I, S68N, I135T, D177E, I178M, G196E, E203G, R211K, F214L, V245M, A272P, I293V, E297K T253TA
>CA3904| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDNTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYVDDLYVGSDLEIEQHRTKIGELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWAVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005