<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1329 CA39038 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 21
2 3TC+ D4T+ NFV 57
3 SQV+ 3TC+ AZT+ RTV 41
4 3TC+ AZT+ EFV+ SQV 20
5 Unknown 210

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I84V, L90M L10F, L33F, K43T, N88D I15V, E35D, M36L, N37E, D60E, I62V, L63P  
>CA39038| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADNTVFEDLELPGRWTPKMIGGIGGFIKVRQYE
QVPIEICGHKAIGTVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H V35R, T39A, K102Q, D123E, I135T, I142V, S162C, T200A, V245T, A272P, I293V, E297K  
>CA39039| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005