<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16426 CA39012 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V Q58E L10Y, R41RK, L63A, T74K, L89M  
>CA39012| codons 1-99
PQITLWQRPYVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVREYD
QIAIEICGHKAIGKVLVGPTPVNVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, T215HY K219Q     K32R, I50IV, K122E, G196R, I202V, V245T, K281R, R284K, T286A, A288T, I293V  
>CA39013| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALVEICTEMEKEGKISKVGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIRQHRTKVEELRQHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLKGAKTLTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005