<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1461 CA3898 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 DDI+ AZT 17
3 DDC+ AZT 40
4 SQV+ DDC+ AZT 103
5 3TC+ AZT 14
6 IDV+ D4T+ 3TC 34
7 DDI+ NVP+ D4T 23
8 SQV+ RTV 44

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W V75L, T215D K103KN, Y181C   K20R, V21I, T39A, K43E, V118I, K122E, D177E, I178M, T200A, Q207E, H208Y, R211K, A272P, K277R, L283I, I293V, E297K E40FS
>CA3898| codons 1-302
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALVEICASLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRAKIEELREYLWKWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L90M F53L, G73T L10I, D60DE, I62V, L63P, A71I, V77I, I93L  
>CA3899| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLVKVRQYE
QVPIEICGHKIITTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005