<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16354 CA38863 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+IDV+NVP 52
2 DDC+EFV+NFV 174
3 3TC+ABC+RTV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V D67G, K70T, K219Q K101P, Y188YC   V60I, S68G, V106VI, K122KE, I135T, D177E, I178M, T200A, R211K, E224D, A272P, K275R, I293V, P294Q, E297K S191SP
>CA38863| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKGGTTWRKVVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLCVGPDLEIGQHRAKIEELRQHLLKWGFTTPDQKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTEVVQLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, L19I, K20T, E35D, M36L, K43R, I62V, L63P, A71I, T74S, V77I, Q92K, I93L  
>CA38862| codons 1-99
PQITLWQRPLVTVKIGGQITEALLDTGADDTVLEDLNLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKIIGSVLIGPTPVNIIGRNLMTKLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009