<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16329 CA38813 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 169
2 3TC+ABC+AZT 52
3 3TC+ABC+AZT+IDV+RTV 144

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K43KDEN, E44D, V111I, D123E, S162FY, I178L, G196E, T200A, E203ED, H208F, R211KN, A272P, K277R, I293V, E297A, E312ED, G333E, P345Q, R356K, G359S, A371V, K390R, A400T, T470P, H483Y, L491S, S519N, E529D, V531I, Q547R, A554T, K558R  
>CA38813| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIEQHRAKIDELRQFLWNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEQFKNLKTGKYAKMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLPDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKDKIYLAWVPAHK
GIGGNERVDKLVSTGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, L90M   L10V, Q18H, L19V, E21Q, N37D, K55R, R57K, D60E, I62V, L63P, C67F, A71V, I72M, V77I, I93L C95I
>CA38812| codons 1-99
PQITLWQRPVVTIKIGGHVKQALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIRVKQYE
QVPIEIFGHKVMGTVVIGPTPVNIIGRNLMTQLGITLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005