<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16315 CA38783 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 213
2 AZT+DDI 22
3 3TC+AZT 57
4 3TC+AZT+IDV 104
5 ABC+D4T+NVP 171

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L210LW T215E, K219Q K103N   K64H, T69N, V90I, A98S, I135IMT, A272P  
>CA38783| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIHKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFETPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82F   L10I, I64V, A71V, V77I, I85V, I93L  
>CA38782| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QILVEICGHKVIGTVLIGPTPFNIVGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009